PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSMUA_Achr2P07420_001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
Family HD-ZIP
Protein Properties Length: 292aa    MW: 33028.8 Da    PI: 6.006
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSMUA_Achr2P07420_001genomeCIRADView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox603.7e-1990143356
                            --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
               Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                            k++++t eq+++Le+ Fe+ +++  e++ +LA+ lgL+ rqV +WFqNrRa++k
  GSMUA_Achr2P07420_001  90 KKRRLTVEQVRTLEKNFEQGNKLEPERKMQLARALGLQPRQVAIWFQNRRARWK 143
                            45689************************************************9 PP

2HD-ZIP_I/II132.41.7e-4289181193
            HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLr 88 
                            ekkrrl+ eqv++LE++Fe+ +kLeperK++lar+Lglqprqva+WFqnrRAR+ktkqlEkdy++Lkr+++a+k+ene+L++++++L+
  GSMUA_Achr2P07420_001  89 EKKRRLTVEQVRTLEKNFEQGNKLEPERKMQLARALGLQPRQVAIWFQNRRARWKTKQLEKDYDVLKRQFEAMKSENEALRAQNQKLH 176
                            69************************************************************************************** PP

            HD-ZIP_I/II  89 eelke 93 
                            +e+++
  GSMUA_Achr2P07420_001 177 AEISA 181
                            99975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.09E-2078147IPR009057Homeodomain-like
PROSITE profilePS5007117.68685145IPR001356Homeobox domain
SMARTSM003899.8E-1988149IPR001356Homeobox domain
CDDcd000863.93E-1790146No hitNo description
PfamPF000461.8E-1690143IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.602.8E-2092145IPR009057Homeodomain-like
PRINTSPR000319.2E-6116125IPR000047Helix-turn-helix motif
PROSITE patternPS000270120143IPR017970Homeobox, conserved site
PRINTSPR000319.2E-6125141IPR000047Helix-turn-helix motif
PfamPF021831.5E-16145185IPR003106Leucine zipper, homeobox-associated
Gene3DG3DSA:1.20.5.1707.7E-4146182No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 292 aa     Download sequence    Send to blast
MSCNGMASSS SSFFSPNYVI HVQTPHEEEH QLSSAVAALL HNTPCNSLQD LRVMAPMIGK  60
RSLSFSGVEN GDEMHADDDF SDDGMQTGEK KRRLTVEQVR TLEKNFEQGN KLEPERKMQL  120
ARALGLQPRQ VAIWFQNRRA RWKTKQLEKD YDVLKRQFEA MKSENEALRA QNQKLHAEIS  180
ALKGREAPEL INLNKETEGS CSNRSENSSE INLDISRTSV TESPLNPHQS LPFIHSIRPA  240
DMDQLLQSSS RPEMQSPKIE TGATEGSFSN LLCGMEDQSA SFWPWSDHPN FH
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1137145RRARWKTKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009389573.10.0PREDICTED: homeobox-leucine zipper protein HOX21-like
SwissprotA2XD081e-102HOX21_ORYSI; Homeobox-leucine zipper protein HOX21
TrEMBLM0S5Y30.0M0S5Y3_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr2P07420_0010.0(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP22893894
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69780.11e-87HD-ZIP family protein